Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Histidine protein kinase saeS (saeS)

This Recombinant Staphylococcus aureus Histidine protein kinase saeS (saeS) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Histidine protein kinase saeS, EC= 2.7.13.3, Sensor protein saeS, Staphylococcus exoprotein expression protein S

UniProt

Q99VR8

Expression Region

1-351

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLSIRSQIIIGVVSSILLTSTILAIAYILMWFNGHMTLTLTLTTIITSCLTLLICSIFI NPLIQKIKQFNIKTKQFANGNYASNDKTFNSPKEIYELNQSFNKMASEITQQMNQIKSEQ QEKTELIQNLAHDLKTPLASIISYSEGLRDGIITKDHEIKESYDILIKQANRLSTLFDDM THIITLNTGKTYPPELIQLDQLLVSILQPYEQRIKHENRTLEVNFCSEIDAFYQYRTPLE RILTNLLDNALKFSNVGSRIDINISENKDQDTIDIAISDEGIGIIPELQERIFERTFRVE NSRNTKTGGSGLGLYIANELAQQNNAKISVSSDIDVGTTMTVTLHKLDITS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PKC zeta (T560) Recombinant Rabbit Monoclonal Antibody [SN0753]
ET1611-78 100 µL

Phospho-PKC zeta (T560) Recombinant Rabbit Monoclonal Antibody [SN0753]

Sign In for Pricing
View Details
H2ap Mouse Gene Knockout Kit (CRISPR)
KN500150 1 Kit

H2ap Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SUMO1 Polyclonal Antibody
E-AB-60626-01 60 µL

SUMO1 Polyclonal Antibody

Sign In for Pricing
View Details
SUMO1 Polyclonal Antibody
E-AB-60626-02 120 µL

SUMO1 Polyclonal Antibody

Sign In for Pricing
View Details
SUMO1 Polyclonal Antibody
E-AB-60626-03 200 µL

SUMO1 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Akr1b8 activation kit by CRISPRa
GA201413 1 Kit

Mouse Akr1b8 activation kit by CRISPRa

Sign In for Pricing
View Details