Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Histidine protein kinase saeS (saeS)

This Recombinant Staphylococcus aureus Histidine protein kinase saeS (saeS) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Histidine protein kinase saeS, EC= 2.7.13.3, Sensor protein saeS, Staphylococcus exoprotein expression protein S

UniProt

Q99VR8

Expression Region

1-351

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLSIRSQIIIGVVSSILLTSTILAIAYILMWFNGHMTLTLTLTTIITSCLTLLICSIFI NPLIQKIKQFNIKTKQFANGNYASNDKTFNSPKEIYELNQSFNKMASEITQQMNQIKSEQ QEKTELIQNLAHDLKTPLASIISYSEGLRDGIITKDHEIKESYDILIKQANRLSTLFDDM THIITLNTGKTYPPELIQLDQLLVSILQPYEQRIKHENRTLEVNFCSEIDAFYQYRTPLE RILTNLLDNALKFSNVGSRIDINISENKDQDTIDIAISDEGIGIIPELQERIFERTFRVE NSRNTKTGGSGLGLYIANELAQQNNAKISVSSDIDVGTTMTVTLHKLDITS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nesvacumab Biosimilar - Research Grade
ICH5010-50mg 50 mg

Nesvacumab Biosimilar - Research Grade

Sign In for Pricing
View Details
ROCK1 Rabbit Polyclonal Antibody
ER40122 100 µL

ROCK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
P2Y12 Recombinant Rabbit Monoclonal Antibody [JE63-23]
HA721011 100 µL

P2Y12 Recombinant Rabbit Monoclonal Antibody [JE63-23]

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (CPTC-ANXA1-1), CF647 conjugate, 0.1mg/mL
BNC472223-100 1x 100 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (CPTC-ANXA1-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Srsf4 Mouse Gene Knockout Kit (CRISPR)
KN516746 1 Kit

Srsf4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Fluoro-6-hydroxyphenylboronic Acid
TRC-F489660-5G 5 g

2-Fluoro-6-hydroxyphenylboronic Acid

Sign In for Pricing
View Details