Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 2 Envelope glycoprotein I (gI)

This Recombinant Human herpesvirus 2 Envelope glycoprotein I (gI) spans the amino acid sequence from region 21-372.

Product Specifications

Product Name Alternative

Envelope glycoprotein I, gI

UniProt

P06764

Expression Region

21-372

Origin

Human herpesvirus 2 (strain 333) (HHV-2) (Human herpes simplex virus 2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LVVRGPTVSLVSDSLVDAGAVGPQGFVEEDLRVFGELHFVGAQVPHTNYYDGIIELFHYP LGNHCPRVVHVVTLTACPRRPAVAFTLCRSTHHAHSPAYPTLELGLARQPLLRVRTATRD YAGLYVLRVWVGSATNASLFVLGVALSANGTFVYNGSDYGSCDPAQLPFSAPRLGPSSVY TPGASRPTPPRTTTSPSSPRDPTPAPGDTGTPAPASGERAPPNSTRSASESRHRLTVAQV IQIAIPASIIAFVFLGSCICFIHRCQRRYRRPRGQIYNPGGVSCAVNEAAMARLGAELRS HPNTPPKPRRRSSSSTTMPSLTSIAEESEPGPVVLLSVSPRPRSGPTAPQEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMC2 Antibody - N-terminal region : HRP (ARP46043_P050-HRP)
ARP46043_P050-HRP 100 µL

SMC2 Antibody - N-terminal region : HRP (ARP46043_P050-HRP)

Sign In for Pricing
View Details
CD86 (E5W6H) & CO-0051-488 SignalStar™ Oligo-Antibody Pair
CST 41124S 1 Kit

CD86 (E5W6H) & CO-0051-488 SignalStar™ Oligo-Antibody Pair

Sign In for Pricing
View Details
Calcium indicator GCaMP6f lentivirus (CMV, Puro) - Calcium indicator GCaMP6f lentivirus (CMV, Puro)
GTR15424721 25 µL (1x 25 µL)

Calcium indicator GCaMP6f lentivirus (CMV, Puro) - Calcium indicator GCaMP6f lentivirus (CMV, Puro)

Sign In for Pricing
View Details
FFPE Tissue Blocks, Lung
CB702273 1 Block

FFPE Tissue Blocks, Lung

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Schizaphis graminum Lipoprotein-releasing system transmembrane protein LolC (lolC)
orb2914496-01 20 µg

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Lipoprotein-releasing system transmembrane protein LolC (lolC)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Schizaphis graminum Lipoprotein-releasing system transmembrane protein LolC (lolC)
orb2914496-02 100 µg

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Lipoprotein-releasing system transmembrane protein LolC (lolC)

Sign In for Pricing
View Details