Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 2 Envelope glycoprotein I (gI)

This Recombinant Human herpesvirus 2 Envelope glycoprotein I (gI) spans the amino acid sequence from region 21-372.

Product Specifications

Product Name Alternative

Envelope glycoprotein I, gI

UniProt

P06764

Expression Region

21-372

Origin

Human herpesvirus 2 (strain 333) (HHV-2) (Human herpes simplex virus 2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LVVRGPTVSLVSDSLVDAGAVGPQGFVEEDLRVFGELHFVGAQVPHTNYYDGIIELFHYP LGNHCPRVVHVVTLTACPRRPAVAFTLCRSTHHAHSPAYPTLELGLARQPLLRVRTATRD YAGLYVLRVWVGSATNASLFVLGVALSANGTFVYNGSDYGSCDPAQLPFSAPRLGPSSVY TPGASRPTPPRTTTSPSSPRDPTPAPGDTGTPAPASGERAPPNSTRSASESRHRLTVAQV IQIAIPASIIAFVFLGSCICFIHRCQRRYRRPRGQIYNPGGVSCAVNEAAMARLGAELRS HPNTPPKPRRRSSSSTTMPSLTSIAEESEPGPVVLLSVSPRPRSGPTAPQEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNIP1, CT (TNIP1, KIAA0113, NAF1, TNFAIP3-interacting protein 1, A20-binding inhibitor of NF-kappa-B activation 1, HIV-1 Nef-interacting protein, Nef-associated factor 1, Nip40-1, Virion-associated nuclear shuttling protein)
043090 200 µL

TNIP1, CT (TNIP1, KIAA0113, NAF1, TNFAIP3-interacting protein 1, A20-binding inhibitor of NF-kappa-B activation 1, HIV-1 Nef-interacting protein, Nef-associated factor 1, Nip40-1, Virion-associated nuclear shuttling protein)

Sign In for Pricing
View Details
Recombinant Saccharophagus degradans Membrane protein insertase YidC (yidC)
orb2908978-01 20 µg

Recombinant Saccharophagus degradans Membrane protein insertase YidC (yidC)

Sign In for Pricing
View Details
Recombinant Saccharophagus degradans Membrane protein insertase YidC (yidC)
orb2908978-02 100 µg

Recombinant Saccharophagus degradans Membrane protein insertase YidC (yidC)

Sign In for Pricing
View Details
MSK1 discontinued
344500-01 100 µL

MSK1 discontinued

Sign In for Pricing
View Details
MSK1 discontinued
344500-02 200 µL

MSK1 discontinued

Sign In for Pricing
View Details
NARFL (CIAO3) (NM_022493) Human Tagged Lenti ORF Clone
RC206978L2 10 µg

NARFL (CIAO3) (NM_022493) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details