Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 2 Envelope glycoprotein I (gI)

This Recombinant Human herpesvirus 2 Envelope glycoprotein I (gI) spans the amino acid sequence from region 21-372.

Product Specifications

Product Name Alternative

Envelope glycoprotein I, gI

UniProt

P06764

Expression Region

21-372

Origin

Human herpesvirus 2 (strain 333) (HHV-2) (Human herpes simplex virus 2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LVVRGPTVSLVSDSLVDAGAVGPQGFVEEDLRVFGELHFVGAQVPHTNYYDGIIELFHYP LGNHCPRVVHVVTLTACPRRPAVAFTLCRSTHHAHSPAYPTLELGLARQPLLRVRTATRD YAGLYVLRVWVGSATNASLFVLGVALSANGTFVYNGSDYGSCDPAQLPFSAPRLGPSSVY TPGASRPTPPRTTTSPSSPRDPTPAPGDTGTPAPASGERAPPNSTRSASESRHRLTVAQV IQIAIPASIIAFVFLGSCICFIHRCQRRYRRPRGQIYNPGGVSCAVNEAAMARLGAELRS HPNTPPKPRRRSSSSTTMPSLTSIAEESEPGPVVLLSVSPRPRSGPTAPQEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine ganglioside induced differentiation associated protein 2 ELISA Kit
OM622583 96 Strip Well

Bovine ganglioside induced differentiation associated protein 2 ELISA Kit

Sign In for Pricing
View Details
CCDC82 Antibody, Biotin conjugated
MBS1494337-01 0.05 mg

CCDC82 Antibody, Biotin conjugated

Sign In for Pricing
View Details
CCDC82 Antibody, Biotin conjugated
MBS1494337-02 0.1 mg

CCDC82 Antibody, Biotin conjugated

Sign In for Pricing
View Details
CCDC82 Antibody, Biotin conjugated
MBS1494337-03 5x 0.1 mg

CCDC82 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal FRMD6 Antibody [Alexa Fluor 594]
NBP3-18421AF594 0.1 mL

Rabbit Polyclonal FRMD6 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to KHDRBS2
MBS8527958-01 0.1 mL

Mouse Monoclonal Antibody to KHDRBS2

Sign In for Pricing
View Details