Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine polyomavirus Minor capsid protein VP2

This Recombinant Bovine polyomavirus Minor capsid protein VP2 spans the amino acid sequence from region 2-353.

Product Specifications

Product Name Alternative

Minor capsid protein VP2, Minor structural protein VP2

UniProt

P24849

Expression Region

2-353

Origin

Bovine polyomavirus (BPyV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GALLTILAEVFELATATGLSAEAILTGEAFTTAELLQAHIANLVEVGELSVAEALAATEV TSEAFEALQSISSVLPTAFIGVAATEGAILGSLITLTATSSALYPSTWKHSTPSANLNQE MALVPYIGDLDIFFPGAETISRFVYSIDPFRWASYLYNIVGRAVWEHLFRETRRQIAYHT TDIAGRTAQSIHHTIANFLENVRWTVSHLGTNLYSGLHNYYRQLPPLNPPQSRELARRLG VPQPDRQIFEKGEEGMKHPVSAEYVEKYGAPGGAEQRVAPDWLLPLLLGLYGDLTPAWEA EVEEEENEQDEEEYEPPQKRIKRTAKSSSKVNNKRGDRSARSPYRTRQHNHN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
BNC400460-500 1x 500 µL

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL
BNC040181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF740 conjugate, 0.1mg/mL
BNC740193-500 1x 500 µL

CD86 (BU63), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
BNC880204-500 1x 500 µL

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (ENO2/1462), CF488A conjugate, 0.1mg/mL
BNC881462-500 1x 500 µL

NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (ENO2/1462), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details