Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein C5orf60 (C5orf60)

This Recombinant Human Putative uncharacterized protein C5orf60 (C5orf60) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Putative uncharacterized protein C5orf60

UniProt

A6NFR6

Expression Region

1-353

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPRAQLPEDSSAVDMDILFPLDSVIGTELCPSPIPQIIHFVLFVVFSLVILIILRLYIPR EPSSVPPREEDSENDQAEVGEWLRIGNKYITLKDYRILLKELENLEIYTFLSKKCLKKLS REGSSHHLPRQVRPGPVYKPAPARNHRPRGGRGKASPTSFHVSPRAPLAPLASMPSSVPK TSVESLGSPSSLSSSKPREPLCPLKHPSHQPPASTLSPNPTSSTESLGYLSSLSSSQPPE PLRPLKHPSHKPRGRSLPRRRNPGWVSWSDSMQADSETDTIICPMCKAPERSCPHTWWVP SSPRVIRGVGRCSDPNLGLSWRQEAARAWCHCTSSQFPFKHPNLPTHLPKASF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Bacillus anthracis cya/EF/Edema factor Antibody (E3#)
MBS1572142-01 0.1 mg

Anti-Bacillus anthracis cya/EF/Edema factor Antibody (E3#)

Sign In for Pricing
View Details
Anti-Bacillus anthracis cya/EF/Edema factor Antibody (E3#)
MBS1572142-02 1 mg

Anti-Bacillus anthracis cya/EF/Edema factor Antibody (E3#)

Sign In for Pricing
View Details
Anti-Bacillus anthracis cya/EF/Edema factor Antibody (E3#)
MBS1572142-03 5x 1 mg

Anti-Bacillus anthracis cya/EF/Edema factor Antibody (E3#)

Sign In for Pricing
View Details
GDPD5 Antibody
A56446-100UL 100 µL

GDPD5 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Perforin Antibody (BOR21)
NBP1-43106-0.1mg 0.1 mg

Mouse Monoclonal Perforin Antibody (BOR21)

Sign In for Pricing
View Details
53BP2 (DX54.10) : m-IgGκ BP-HRP Bundle
sc-551067 1 Kit

53BP2 (DX54.10) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details