Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Citrobacter koseri UPF0283 membrane protein CKO_01392 (CKO_01392)

This Recombinant Citrobacter koseri UPF0283 membrane protein CKO_01392 (CKO_01392) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

UPF0283 membrane protein CKO_01392

UniProt

A8AGB5

Expression Region

1-353

Origin

Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEPLKPRIDFAGPLEVEQNQTLKTQQTFSETQAQTFAPAQVDEPLEDEGQAEAVIDAAL RPKRSLWRKMVMGGLALFGVSVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVA TEWRRLWRLRQRAHERDEARDLLHSHGTGKGRAFCEKLAQQAGIDQSHPALQRWYASIHE TQNDREVVSLYAQLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFRLVLLNIAFAGASELVREVGMDWMSQDLAARLSARAAQGIG AGLLTARLGIKAMELCRPLPWIDDDKPRLGDFRRQLIVQVKETLQKSKTPREN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL
BNC940225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF594 conjugate, 0.1mg/mL
BNC940008-500 1x 500 µL

MAGE A1 (MA454), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF568 conjugate, 0.1mg/mL
BNC680851-500 1x 500 µL

HSP60 (LK1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL
BNC470158-100 1x 100 µL

Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2168), CF647 conjugate, 0.1mg/mL
BNC472168-500 1x 500 µL

Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2168), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (HMPV), CF488A conjugate, 0.1mg/mL
BNC880954-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (HMPV), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details