Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage If1 Gene 1 protein (I)

This Recombinant Enterobacteria phage If1 Gene 1 protein (I) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Gene 1 protein, G1P

UniProt

O80299

Expression Region

1-353

Origin

Enterobacteria phage If1 (Bacteriophage If1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVYVVTGKLGAGKTLVAVGKIQDKIVSGCRVATNLDLRIHKLPRVGIFAKSPDVIRIPD KPSLDDLLAIGRGNNSYDENKNGLLVLDECGTWFNSRSWADKERQSVINWFLHARKLGWD IIFLIQDLSIMDKQARVALAEHVVYCRRLDKITIPFIGSIYSVITGSKLPLPKVHVGIVK YGDSPQSMTVERWTYTGRDLYAAYDTKQAFSDAYEHSSFSYLTPYLSHGRYAVKRDATFY MRLTRIYLKKYSRVLCLFCGFVSAFTYLSLSKPEATPQIKPVTTQIITSRYKPSELRITT SYRMGNAVGFEFMDAKKQKIASDDLIKDGFRMVYITPCSVELIKDGKHEKVTC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
BNC880225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL
BNC471050-500 1x 500 µL

CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
BNC470218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF647 conjugate, 0.1mg/mL
BNC470871-500 1x 500 µL

CD71 (66IG10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL
BNC940029-100 1x 100 µL

Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL
BNC400225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details