Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pseudotuberculosis serotype O:3 UPF0283 membrane protein YPK_1899 (YPK_1899)

This Recombinant Yersinia pseudotuberculosis serotype O:3 UPF0283 membrane protein YPK_1899 (YPK_1899) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

UPF0283 membrane protein YPK_1899

UniProt

B1JJS9

Expression Region

1-353

Origin

Yersinia pseudotuberculosis serotype O:3 (strain YPIII)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEPLKPRIDFEQPLQSLDEPVLKSAQAFDEQAAEKFYPAAPELDAEDEEGRVEGLVNAA LKPKRSLWRKMVTAGMVILGASVIAQSVQWVNQAWQQQDWIALGATTAGGLIILAGVGSV VTEWRRLYHLRQRAEERDIARALLVSHGVGQGRVFCEKLARQAGLDQGHPALQRWQASLH ETHNDREVVELYAKLVQPALDNQARAEISRYAAESALMIAVSPLALVDMAFIAWRNIRLI NRIAALYGIELGYFSRIRLFRLVLLNIAFAGASELVREVGMDWLSQDLAARLSARAAQGI GAGLLTARLGIKAMELCRPLPWLEGDKPKLGDFRRQLMNQLKNTLPKKDKTAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF488A conjugate, 0.1mg/mL
BNC880345-500 1x 500 µL

CD4 (EDU-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
BNC880270-100 1x 100 µL

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL
BNC400008-500 1x 500 µL

MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL
BNC470633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
BNC940460-500 1x 500 µL

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF740 conjugate, 0.1mg/mL
BNC741052-500 1x 500 µL

CD3e (B-B12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details