Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Probable quinol oxidase subunit 2 (qoxA)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus Probable quinol oxidase subunit 2 (qoxA) spans the amino acid sequence from region 20-373.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 2, EC= 1.10.3.-, Quinol oxidase polypeptide II

UniProt

Q49WI4

Expression Region

20-373

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSNVEVLNPKGPMASDSKFLIMYSIIFMLVIIAAVLILFTVFLYKYRIGNTDESGKMHHN SLLETIWFIIPVIIVIALAIPTVNSLYNYEEKPQKEDDPLVVYATSAGYKWFFSYPEEKI ETVNHLTIPKDRPVVFKLQSMDMMTSFWIPQLGGQKYAMTGMTMDWTLTASEEGTFRGRN SNFNGEGFSRQTFDVNSVSQSKFEDWVKDAKKQKVLDQDTFDKQLLPTTENKNLTFSGTH LAFVDPAADPEYIFYAYDRYNFVQKDPNFNTEEERTADVLDKPDQPARKPEITNANYERH GMKAMILGNNEPYDSEFKDEESHNMDEMEKISEGAKDEKASKIEKKDHENGGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Idnk (NM_198004) Mouse Tagged ORF Clone
MG201523 10 µg

Idnk (NM_198004) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS506206 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
Esm1 (BC020038) Mouse Tagged ORF Clone
MG201703 10 µg

Esm1 (BC020038) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Spirodiclofen
TRC-S682990-250MG 250 mg

Spirodiclofen

Sign In for Pricing
View Details
Human OBSCN activation kit by CRISPRa
GA113338 1 Kit

Human OBSCN activation kit by CRISPRa

Sign In for Pricing
View Details
Weighing Scale BBAL-414
BBAL-414 1 Unit

Weighing Scale BBAL-414

Sign In for Pricing
View Details