Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Probable quinol oxidase subunit 2 (qoxA)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus Probable quinol oxidase subunit 2 (qoxA) spans the amino acid sequence from region 20-373.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 2, EC= 1.10.3.-, Quinol oxidase polypeptide II

UniProt

Q49WI4

Expression Region

20-373

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSNVEVLNPKGPMASDSKFLIMYSIIFMLVIIAAVLILFTVFLYKYRIGNTDESGKMHHN SLLETIWFIIPVIIVIALAIPTVNSLYNYEEKPQKEDDPLVVYATSAGYKWFFSYPEEKI ETVNHLTIPKDRPVVFKLQSMDMMTSFWIPQLGGQKYAMTGMTMDWTLTASEEGTFRGRN SNFNGEGFSRQTFDVNSVSQSKFEDWVKDAKKQKVLDQDTFDKQLLPTTENKNLTFSGTH LAFVDPAADPEYIFYAYDRYNFVQKDPNFNTEEERTADVLDKPDQPARKPEITNANYERH GMKAMILGNNEPYDSEFKDEESHNMDEMEKISEGAKDEKASKIEKKDHENGGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCTD21 (NM_001029859) Human Recombinant Protein
TP306177L 1 mg

KCTD21 (NM_001029859) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS714055 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details
Human Lipocalin-2 Recombinant Rabbit monoclonal Antibody
HA725111B 100 µL

Human Lipocalin-2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
FITC Anti-Human CD32 Antibody[IV-3]
E-AB-F1075C-01 20 Tests

FITC Anti-Human CD32 Antibody[IV-3]

Sign In for Pricing
View Details
FITC Anti-Human CD32 Antibody[IV-3]
E-AB-F1075C-02 100 Tests

FITC Anti-Human CD32 Antibody[IV-3]

Sign In for Pricing
View Details
FITC Anti-Human CD32 Antibody[IV-3]
E-AB-F1075C-03 2x 100 Tests

FITC Anti-Human CD32 Antibody[IV-3]

Sign In for Pricing
View Details