Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GRAM domain-containing protein 2 (GRAMD2)

This Recombinant Human GRAM domain-containing protein 2 (GRAMD2) spans the amino acid sequence from region 1-354.

Product Specifications

Product Name Alternative

GRAM domain-containing protein 2

UniProt

Q8IUY3

Expression Region

1-354

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTALSRSEATEEGGNQQMHRKTASLNSPVSCKEKPDRVEEPPDYSLHWPEGLKGEEIKKC GREGITLNKYNQQYHKLFKDVPLEEVVLKVCSCALQRDFLLQGRLYISPNWLCFHASLFG KDIKVVIPVVSVQMIKKHKMARLLPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHL QPSSKKSLSVREFSGEPESLEVLIPEMKWRKVCPSSRSLSLPDNIPCIPPSSVDSTDSFF PSRKPPMSEKSRAQVASENGGRWAWPMPGWGPACPKKMPNCSPTAKNAVYEEDELEEEPR STGELRLWDYRLLKVFFVLICFLVMSSSYLAFRISRLEQQLCSLSWDDPVPGHR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human DUSP11 shRNA (UAS) - Lentiviral human DUSP11 shRNA (UAS, GFP) (100)
GTR15132081 1 Vial

Lentiviral human DUSP11 shRNA (UAS) - Lentiviral human DUSP11 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Herpes Simplex Virus 2 (HSV 2-gE) discontinued. see 375978
470864 100 µg

Herpes Simplex Virus 2 (HSV 2-gE) discontinued. see 375978

Sign In for Pricing
View Details
5- (2-Furyl) -2-hydroxybenzoic acid
orb2283872-01 1 mg

5- (2-Furyl) -2-hydroxybenzoic acid

Sign In for Pricing
View Details
5- (2-Furyl) -2-hydroxybenzoic acid
orb2283872-02 2 mg

5- (2-Furyl) -2-hydroxybenzoic acid

Sign In for Pricing
View Details
5- (2-Furyl) -2-hydroxybenzoic acid
orb2283872-03 5 mg

5- (2-Furyl) -2-hydroxybenzoic acid

Sign In for Pricing
View Details
5- (2-Furyl) -2-hydroxybenzoic acid
orb2283872-04 10 mg

5- (2-Furyl) -2-hydroxybenzoic acid

Sign In for Pricing
View Details