Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GRAM domain-containing protein 2 (GRAMD2)

This Recombinant Human GRAM domain-containing protein 2 (GRAMD2) spans the amino acid sequence from region 1-354.

Product Specifications

Product Name Alternative

GRAM domain-containing protein 2

UniProt

Q8IUY3

Expression Region

1-354

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTALSRSEATEEGGNQQMHRKTASLNSPVSCKEKPDRVEEPPDYSLHWPEGLKGEEIKKC GREGITLNKYNQQYHKLFKDVPLEEVVLKVCSCALQRDFLLQGRLYISPNWLCFHASLFG KDIKVVIPVVSVQMIKKHKMARLLPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHL QPSSKKSLSVREFSGEPESLEVLIPEMKWRKVCPSSRSLSLPDNIPCIPPSSVDSTDSFF PSRKPPMSEKSRAQVASENGGRWAWPMPGWGPACPKKMPNCSPTAKNAVYEEDELEEEPR STGELRLWDYRLLKVFFVLICFLVMSSSYLAFRISRLEQQLCSLSWDDPVPGHR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Adropin Antibody [DyLight 650]
NBP2-81884C 0.1 mL

Rabbit Polyclonal Adropin Antibody [DyLight 650]

Sign In for Pricing
View Details
RALB Mouse Monoclonal Antibody [Clone ID: OTI2C4]
TA505880 100 µL

RALB Mouse Monoclonal Antibody [Clone ID: OTI2C4]

Sign In for Pricing
View Details
Recombinant Salmonella newport UPF0509 protein yciZ (yciZ)
MBS1170911-01 0.02 mg (E-Coli)

Recombinant Salmonella newport UPF0509 protein yciZ (yciZ)

Sign In for Pricing
View Details
Recombinant Salmonella newport UPF0509 protein yciZ (yciZ)
MBS1170911-02 0.1 mg (E-Coli)

Recombinant Salmonella newport UPF0509 protein yciZ (yciZ)

Sign In for Pricing
View Details
Recombinant Salmonella newport UPF0509 protein yciZ (yciZ)
MBS1170911-03 0.02 mg (Yeast)

Recombinant Salmonella newport UPF0509 protein yciZ (yciZ)

Sign In for Pricing
View Details
Recombinant Salmonella newport UPF0509 protein yciZ (yciZ)
MBS1170911-04 0.1 mg (Yeast)

Recombinant Salmonella newport UPF0509 protein yciZ (yciZ)

Sign In for Pricing
View Details