Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis C virus Genome polyprotein

This Recombinant Hepatitis C virus Genome polyprotein spans the amino acid sequence from region 384-737.

Product Specifications

Product Name Alternative

Genome polyprotein, Cleaved into the following 4 chains:, 1. Core protein p21, Capsid protein C, p21, Core protein p19, Envelope glycoprotein E1, gp32, gp35, Envelope g

UniProt

P27961

Expression Region

384-737

Origin

Hepatitis C virus (isolate HC-J7) (HCV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

STQVTGGQAAHTVRGVASIFSPGSRQDISLINTNGSWHINRTALNCNDSLQTGFFAALFY VRRFNSSGCPERLSSCRKLDDFRIGWGTLEYETNVTNEEDMRPYCWHYPPKPCGIVSAKT VCGPVYCFTPSPVVVGTTDRQGVPTYSWGENETDVFLLNSTRPPRGAWFGCTWMNGTGFT KTCGAPPCRIRRDYNGTLDLLCPTDCFRKHPDTTYLKCGAGPWLTPRCLVDYPYRLWHYP CTVNFTIFKVRMYVGGVEHRLDAACNFTRGDRCRLEDRDRSQQSPLLHSTTEWAVLPCSY SDLPALSTGLLHLHQNIVDVQYLYGLSPAITRHIVKWEWVILLFLLLADARVCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Basic Salivary Proline Rich Protein 1 (PRB1) ELISA Kit
abx355720 96 Well

Chicken Basic Salivary Proline Rich Protein 1 (PRB1) ELISA Kit

Sign In for Pricing
View Details
Human CDH6 qPCR Primer Pair
QH11669S 200 Tests

Human CDH6 qPCR Primer Pair

Sign In for Pricing
View Details
SIM2 Rabbit pAb, BF700 conjugated
orb2879960 100 µL

SIM2 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Mouse Tankyrase-2 (TNKS2) ELISA Kit
AE13941MO-01 48 Tests

Mouse Tankyrase-2 (TNKS2) ELISA Kit

Sign In for Pricing
View Details
Mouse Tankyrase-2 (TNKS2) ELISA Kit
AE13941MO-02 96 Tests

Mouse Tankyrase-2 (TNKS2) ELISA Kit

Sign In for Pricing
View Details
Human Phospholipid Scramblase 4 (PLSCR4) ELISA Kit
abx382304 96 Tests

Human Phospholipid Scramblase 4 (PLSCR4) ELISA Kit

Sign In for Pricing
View Details