Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ML2433 (ML2433)

This Recombinant Uncharacterized protein ML2433 (ML2433) spans the amino acid sequence from region 1-355.

Product Specifications

Product Name Alternative

Uncharacterized protein ML2433

UniProt

P54580

Expression Region

1-355

Origin

Mycobacterium leprae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTGPHNDTESPHARPISVAELLARNGTIGAPAVSRRRRRRTDSDAVTVAELTCDIPIIHD DHADEQHLAATHAHRANIGVRVVEPAAQSPLEPVCEGIVAEPPVDDHGHVPPGCWSAPEP RWPKSPPLTHLRTGLQRSACSRPLPHLGDVRHPVAPDSIAQKQSDAEGMSPDPVEPFADI PVDVMGSEVRAAELVAEESAYARYNLQMSAGALFSGHTLTNELAERRGDEHAAGGLLAVG IDLDEDHLDLHTDLAGITSPARGWQSRFEALWRGSLIVLQSILAVVFGAGLFVAFDQLWR WNSIVALVLSVLVILGLVVGVRVVRRTEDIASTLIAVVVGALITLGPLALSLQSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTK9L, NT (TWF2, PTK9L, Twinfilin-2, A6-related protein, Protein tyrosine kinase 9-like, Twinfilin-1-like protein) (MaxLight 750)
MBS6338841-01 0.1 mL

PTK9L, NT (TWF2, PTK9L, Twinfilin-2, A6-related protein, Protein tyrosine kinase 9-like, Twinfilin-1-like protein) (MaxLight 750)

Sign In for Pricing
View Details
PTK9L, NT (TWF2, PTK9L, Twinfilin-2, A6-related protein, Protein tyrosine kinase 9-like, Twinfilin-1-like protein) (MaxLight 750)
MBS6338841-02 5x 0.1 mL

PTK9L, NT (TWF2, PTK9L, Twinfilin-2, A6-related protein, Protein tyrosine kinase 9-like, Twinfilin-1-like protein) (MaxLight 750)

Sign In for Pricing
View Details
Human Ran Binding Protein 9 c (PSMB7) ELISA Kit
orb3032699-01 48 Tests

Human Ran Binding Protein 9 c (PSMB7) ELISA Kit

Sign In for Pricing
View Details
Human Ran Binding Protein 9 c (PSMB7) ELISA Kit
orb3032699-02 96 Tests

Human Ran Binding Protein 9 c (PSMB7) ELISA Kit

Sign In for Pricing
View Details
Mmu-miR-3104-3p miRNA Antagomir
CIN0802-01 10 nmol

Mmu-miR-3104-3p miRNA Antagomir

Sign In for Pricing
View Details
Mmu-miR-3104-3p miRNA Antagomir
CIN0802-02 20 nmol

Mmu-miR-3104-3p miRNA Antagomir

Sign In for Pricing
View Details