Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant B-lymphotropic polyomavirus Minor capsid protein VP2

This Recombinant B-lymphotropic polyomavirus Minor capsid protein VP2 spans the amino acid sequence from region 2-356.

Product Specifications

Product Name Alternative

Minor capsid protein VP2, Minor structural protein VP2

UniProt

P04011

Expression Region

2-356

Origin

B-lymphotropic polyomavirus (LPV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGVLSLLFNISEIAAELSLSTGFTVDAILTGEAFAAVSTEAAWLIEIEAVDLAGLSTLEA LSLTGLTTEQFSLLSAIPTALNNAIGIGVFFQTVSGASAVVAAGVTTFGYSKEVPVVNMA LVPWFPQVDYLFPGFTSFSYYLNAVLDWGESLFHAVGREVWRHLMRQATLQIGQATRAVA VRSTNELSHTLAQIAENARWALTSGPVHIYSSVQDYYRYLPARNPIQLRQEYRNRGEPPP SRADFEYQENREGQRARRELGYDEPRSGQYVEHYTAPGGAHQRVTQDWMLPLILGLYGDI TPTWEVELNKLEKEEDGPSKKKARRSMQKNMPYSRSRPQAPSKRRSRGARSKNRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Anti-Mouse CD69-BIOT
1715-08 0.5 mg

Hamster Anti-Mouse CD69-BIOT

Sign In for Pricing
View Details
LentimiRa-Off-mmu-miR-466l-3p Vector
mm30769 500 ng

LentimiRa-Off-mmu-miR-466l-3p Vector

Sign In for Pricing
View Details
CADM2 ORF Vector (Human) (pORF)
ORF016806 1.0 µg DNA

CADM2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Anti-SOCS2 Antibody Picoband® (Dylight550 Conjugate)
PB9400-Dylight550 100 µg

Anti-SOCS2 Antibody Picoband® (Dylight550 Conjugate)

Sign In for Pricing
View Details
Fbxo22 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4544403 1.0 µg DNA

Fbxo22 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Cyclin H Monoclonal Antibody
UB-GEN-15983 100 µL

Cyclin H Monoclonal Antibody

Sign In for Pricing
View Details