Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus haemolyticus Probable quinol oxidase subunit 2 (qoxA)

This Recombinant Staphylococcus haemolyticus Probable quinol oxidase subunit 2 (qoxA) spans the amino acid sequence from region 20-374.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 2, EC= 1.10.3.-, Quinol oxidase polypeptide II

UniProt

Q4L565

Expression Region

20-374

Origin

Staphylococcus haemolyticus (strain JCSC1435)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSNVEVFNAKGPVASSQKFLIIYSIIFMLVIVAVVLTMFAIFIFKYSYNKNSETGKMHHN SLIETIWFVVPIIIVIALSIPTVKTLYDYEKPPESKEDPMVVYAVSAGYKWFFAYPEQKV ETVNTLTIPKNRPVVFKLQAMDTMTSFWIPQLGGQKYAMTGMTMNWTLQADETGTFRGRN SNFNGEGFSRQTFKVHSVDQSEFDSWVKDAKSKKTLSQDEFDKQLLPSTPNKELTFSGTH MAFVDPAADPEYIFYAYKRYNYVQKDPNFVAEKDLYKDVTDKPQKPARKVQITNANYKRH GMKPMILGNNDPYDNEFKKEEDHNSKEMEKISKSAKDENASKFGSKADNDHGGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8 (KRT8) (KRT8/2115), CF640R conjugate, 0.1mg/mL
BNC402115-100 1x 100 µL

Cytokeratin 8 (KRT8) (KRT8/2115), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant STAT5b Monoclonal Antibody
E-AB-81513-01 50 µL

Recombinant STAT5b Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant STAT5b Monoclonal Antibody
E-AB-81513-02 100 µL

Recombinant STAT5b Monoclonal Antibody

Sign In for Pricing
View Details
Triethylene Glycol Ditosylate
TRC-E917743-500MG 500 mg

Triethylene Glycol Ditosylate

Sign In for Pricing
View Details
Cytoskeletal Marker Antibody Sampler Kit
HAK21084 1 Kit

Cytoskeletal Marker Antibody Sampler Kit

Sign In for Pricing
View Details
Kir5.1 Rabbit Polyclonal Antibody
ER1901-24 100 µL

Kir5.1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details