Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus haemolyticus Probable quinol oxidase subunit 2 (qoxA)

This Recombinant Staphylococcus haemolyticus Probable quinol oxidase subunit 2 (qoxA) spans the amino acid sequence from region 20-374.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 2, EC= 1.10.3.-, Quinol oxidase polypeptide II

UniProt

Q4L565

Expression Region

20-374

Origin

Staphylococcus haemolyticus (strain JCSC1435)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSNVEVFNAKGPVASSQKFLIIYSIIFMLVIVAVVLTMFAIFIFKYSYNKNSETGKMHHN SLIETIWFVVPIIIVIALSIPTVKTLYDYEKPPESKEDPMVVYAVSAGYKWFFAYPEQKV ETVNTLTIPKNRPVVFKLQAMDTMTSFWIPQLGGQKYAMTGMTMNWTLQADETGTFRGRN SNFNGEGFSRQTFKVHSVDQSEFDSWVKDAKSKKTLSQDEFDKQLLPSTPNKELTFSGTH MAFVDPAADPEYIFYAYKRYNYVQKDPNFVAEKDLYKDVTDKPQKPARKVQITNANYKRH GMKPMILGNNDPYDNEFKKEEDHNSKEMEKISKSAKDENASKFGSKADNDHGGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTBP (667-812) Mouse Monoclonal Antibody [Clone ID: PHL-1]
AM08479SU-N 100 µL

MTBP (667-812) Mouse Monoclonal Antibody [Clone ID: PHL-1]

Sign In for Pricing
View Details
Mouse Col19a1 activation kit by CRISPRa
GA200811 1 Kit

Mouse Col19a1 activation kit by CRISPRa

Sign In for Pricing
View Details
CANT1 Antibody (Biotin)
KB-7566-01 50 μL

CANT1 Antibody (Biotin)

Sign In for Pricing
View Details
CANT1 Antibody (Biotin)
KB-7566-02 100 µL

CANT1 Antibody (Biotin)

Sign In for Pricing
View Details
CANT1 Antibody (Biotin)
KB-7566-03 1 mL

CANT1 Antibody (Biotin)

Sign In for Pricing
View Details
Fodrin / Alpha Spectrin II (SPTAN1) / NEAS (SPTAN1/3351), CF405S conjugate, 0.1mg/mL
BNC043351-100 1x 100 µL

Fodrin / Alpha Spectrin II (SPTAN1) / NEAS (SPTAN1/3351), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details