Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Probable quinol oxidase subunit 2 (qoxA)

This Recombinant Staphylococcus epidermidis Probable quinol oxidase subunit 2 (qoxA) spans the amino acid sequence from region 20-374.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 2, EC= 1.10.3.-, Quinol oxidase polypeptide II

UniProt

Q5HQA9

Expression Region

20-374

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSNIEVFNAKGPVASSQKFLIIYSIIFMLVIVAVVLSMFAIFIFKYSYKKNSESGKMHHN SLIETIWFVVPILIVIALAIPTVKTLYDYEKPPEKDKDPLVVYAVSAGYKWFFAYPDQHI ETVNTLTIPKDRPVVFKLQSMDTMTSFWIPQLGGQKYAMTGMTMNWTLTADQLGTFRGRN SNFNGEGFSRQTFKVHSVSQNDFDKWVKEAKGKKTLSQDTFDKQLLPSTSNKELTFSGTH MAFVDPAADPEYIFYAYKRYNFEQKDPNFTAEEDLYKDVKDKPIKPARKVHITNPNYERH GMKPMILGNNEKYDNEFKKEEDHNSKEMEKISKGAKDENASKLHKKEHDDHGGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tas2r144 Mouse shRNA Lentiviral Particle (Locus ID 387515)
TL514928V 500 µL Each

Tas2r144 Mouse shRNA Lentiviral Particle (Locus ID 387515)

Sign In for Pricing
View Details
Anti-Apoptosis repressor with CARD antibody
MBS175694-01 0.01 mg

Anti-Apoptosis repressor with CARD antibody

Sign In for Pricing
View Details
Anti-Apoptosis repressor with CARD antibody
MBS175694-02 0.1 mg (Carrier Free)

Anti-Apoptosis repressor with CARD antibody

Sign In for Pricing
View Details
Anti-Apoptosis repressor with CARD antibody
MBS175694-03 0.1 mg

Anti-Apoptosis repressor with CARD antibody

Sign In for Pricing
View Details
Anti-Apoptosis repressor with CARD antibody
MBS175694-04 0.1 mg (Cy3)

Anti-Apoptosis repressor with CARD antibody

Sign In for Pricing
View Details
Anti-Apoptosis repressor with CARD antibody
MBS175694-05 0.1 mg (Biotin)

Anti-Apoptosis repressor with CARD antibody

Sign In for Pricing
View Details