Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Probable quinol oxidase subunit 2 (qoxA)

This Recombinant Staphylococcus epidermidis Probable quinol oxidase subunit 2 (qoxA) spans the amino acid sequence from region 20-374.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 2, EC= 1.10.3.-, Quinol oxidase polypeptide II

UniProt

Q5HQA9

Expression Region

20-374

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSNIEVFNAKGPVASSQKFLIIYSIIFMLVIVAVVLSMFAIFIFKYSYKKNSESGKMHHN SLIETIWFVVPILIVIALAIPTVKTLYDYEKPPEKDKDPLVVYAVSAGYKWFFAYPDQHI ETVNTLTIPKDRPVVFKLQSMDTMTSFWIPQLGGQKYAMTGMTMNWTLTADQLGTFRGRN SNFNGEGFSRQTFKVHSVSQNDFDKWVKEAKGKKTLSQDTFDKQLLPSTSNKELTFSGTH MAFVDPAADPEYIFYAYKRYNFEQKDPNFTAEEDLYKDVKDKPIKPARKVHITNPNYERH GMKPMILGNNEKYDNEFKKEEDHNSKEMEKISKGAKDENASKLHKKEHDDHGGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CALB2 Rabbit Polyclonal Antibody (Cy5.5)
orb1054543 100 µL

CALB2 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Nol4l (NM_001134300) Mouse Tagged Lenti ORF Clone
MR214274L3 10 µg

Nol4l (NM_001134300) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse IFNA5 Protein, His Tag
E40MOP1860 20 µg

Mouse IFNA5 Protein, His Tag

Sign In for Pricing
View Details
Mouse Monoclonal AHNAK Antibody (EM-09) [DyLight 550]
NBP2-62204R 0.1 mL

Mouse Monoclonal AHNAK Antibody (EM-09) [DyLight 550]

Sign In for Pricing
View Details
Rabbit Polyclonal DDX43 Antibody [Alexa Fluor 700]
NBP1-28701AF700 0.1 mL

Rabbit Polyclonal DDX43 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Schibitubin I
HY-N11172 1 Each

Schibitubin I

Sign In for Pricing
View Details