Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Probable quinol oxidase subunit 2 (qoxA)

This Recombinant Staphylococcus epidermidis Probable quinol oxidase subunit 2 (qoxA) spans the amino acid sequence from region 20-374.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 2, EC= 1.10.3.-, Quinol oxidase polypeptide II

UniProt

Q8CPP6

Expression Region

20-374

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSNIEVFNAKGPVASSQKFLIIYSIIFMLVIVAVVLSMFAIFIFKYSYKKNSESGKMHHN SLIETIWFVVPILIVIALAIPTVKTLYDYEKPPEKDKDPLVVYAVSAGYKWFFAYPDQHI ETVNTLTIPKDRPVVFKLQSMDTMTSFWIPQLGGQKYAMTGMTMNWTLTADQLGTFRGRN SNFNGEGFSRQTFKVHSVSQNDFDKWVKEAKGKKTLSQDTFDKQLLPSTSNKELTFSGTH MAFVDPAADPEYIFYAYKRYNFEQKDPNFTAEEDLYKDVKDKPIKPARKVHITNPNYERH GMKPMILGNNEKYDNEFKKEEDHNSKEMEKISKGAKDENASKLHKKEHDDHGGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® A7 Anti-human CD140b Antibody *18A2*
114010S1-AAT 500 Tests

IFluor® A7 Anti-human CD140b Antibody *18A2*

Sign In for Pricing
View Details
SCAMP3 (Secretory Carrier Membrane Protein 3, OTTHUMP00000034066, Propin 1, C1orf3) (PE)
MBS6161455-01 0.1 mL

SCAMP3 (Secretory Carrier Membrane Protein 3, OTTHUMP00000034066, Propin 1, C1orf3) (PE)

Sign In for Pricing
View Details
SCAMP3 (Secretory Carrier Membrane Protein 3, OTTHUMP00000034066, Propin 1, C1orf3) (PE)
MBS6161455-02 5x 0.1 mL

SCAMP3 (Secretory Carrier Membrane Protein 3, OTTHUMP00000034066, Propin 1, C1orf3) (PE)

Sign In for Pricing
View Details
DEK Antibody - N-terminal region : HRP (P100637_T100-HRP)
P100637_T100-HRP 100 µL

DEK Antibody - N-terminal region : HRP (P100637_T100-HRP)

Sign In for Pricing
View Details
COX4-1 monoclonal antibody
orb1677671-01 50 µL

COX4-1 monoclonal antibody

Sign In for Pricing
View Details
COX4-1 monoclonal antibody
orb1677671-02 100 µL

COX4-1 monoclonal antibody

Sign In for Pricing
View Details