Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Probable quinol oxidase subunit 2 (qoxA)

This Recombinant Staphylococcus epidermidis Probable quinol oxidase subunit 2 (qoxA) spans the amino acid sequence from region 20-374.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 2, EC= 1.10.3.-, Quinol oxidase polypeptide II

UniProt

Q8CPP6

Expression Region

20-374

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSNIEVFNAKGPVASSQKFLIIYSIIFMLVIVAVVLSMFAIFIFKYSYKKNSESGKMHHN SLIETIWFVVPILIVIALAIPTVKTLYDYEKPPEKDKDPLVVYAVSAGYKWFFAYPDQHI ETVNTLTIPKDRPVVFKLQSMDTMTSFWIPQLGGQKYAMTGMTMNWTLTADQLGTFRGRN SNFNGEGFSRQTFKVHSVSQNDFDKWVKEAKGKKTLSQDTFDKQLLPSTSNKELTFSGTH MAFVDPAADPEYIFYAYKRYNFEQKDPNFTAEEDLYKDVKDKPIKPARKVHITNPNYERH GMKPMILGNNEKYDNEFKKEEDHNSKEMEKISKGAKDENASKLHKKEHDDHGGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM129A (Family with Sequence Similarity 129 Member A, GIG39, NIBAN, C1orf24) (AP)
MBS6416816-01 0.1 mL

FAM129A (Family with Sequence Similarity 129 Member A, GIG39, NIBAN, C1orf24) (AP)

Sign In for Pricing
View Details
FAM129A (Family with Sequence Similarity 129 Member A, GIG39, NIBAN, C1orf24) (AP)
MBS6416816-02 5x 0.1 mL

FAM129A (Family with Sequence Similarity 129 Member A, GIG39, NIBAN, C1orf24) (AP)

Sign In for Pricing
View Details
Liver FABP Rabbit Polyclonal Antibody (APC)
orb1005922 100 µL

Liver FABP Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Rabbit anti-human fatty acid binding protein 4, adipocyte polyclonal Antibody
MBS713927-01 0.1 mL

Rabbit anti-human fatty acid binding protein 4, adipocyte polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human fatty acid binding protein 4, adipocyte polyclonal Antibody
MBS713927-02 5x 0.1 mL

Rabbit anti-human fatty acid binding protein 4, adipocyte polyclonal Antibody

Sign In for Pricing
View Details
7-oxo-Deoxycholic acid
MBS3920467-01 10 mg

7-oxo-Deoxycholic acid

Sign In for Pricing
View Details