Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Probable quinol oxidase subunit 2 (qoxA)

This Recombinant Staphylococcus epidermidis Probable quinol oxidase subunit 2 (qoxA) spans the amino acid sequence from region 20-374.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 2, EC= 1.10.3.-, Quinol oxidase polypeptide II

UniProt

Q8CPP6

Expression Region

20-374

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSNIEVFNAKGPVASSQKFLIIYSIIFMLVIVAVVLSMFAIFIFKYSYKKNSESGKMHHN SLIETIWFVVPILIVIALAIPTVKTLYDYEKPPEKDKDPLVVYAVSAGYKWFFAYPDQHI ETVNTLTIPKDRPVVFKLQSMDTMTSFWIPQLGGQKYAMTGMTMNWTLTADQLGTFRGRN SNFNGEGFSRQTFKVHSVSQNDFDKWVKEAKGKKTLSQDTFDKQLLPSTSNKELTFSGTH MAFVDPAADPEYIFYAYKRYNFEQKDPNFTAEEDLYKDVKDKPIKPARKVHITNPNYERH GMKPMILGNNEKYDNEFKKEEDHNSKEMEKISKGAKDENASKLHKKEHDDHGGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PYCR1 Antibody Picoband®, Dylight550 Conjugate
A06018-1-Dylight550 100 µg

Anti-PYCR1 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
Chicken TSC22 domain family protein 1,TSC22D1 ELISA KIT
ELI-05367c 96 Tests

Chicken TSC22 domain family protein 1,TSC22D1 ELISA KIT

Sign In for Pricing
View Details
PREX1 Protein Vector (Rat) (pPM-C-HA)
37599026 500 ng

PREX1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
SH3RF3 Antibody
A48676-100UL 100 µL

SH3RF3 Antibody

Sign In for Pricing
View Details
Troponin T, Cardiac Muscle (TNNT2) Antibody
abx174946 1 mL

Troponin T, Cardiac Muscle (TNNT2) Antibody

Sign In for Pricing
View Details
Fmoc-4-bis (2-chloroethyl) amino-L-phenylalanine
sc-327701A 500 mg

Fmoc-4-bis (2-chloroethyl) amino-L-phenylalanine

Sign In for Pricing
View Details