Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Protein ATP1B4 (ATP1B4)

This Recombinant Pig Protein ATP1B4 (ATP1B4) spans the amino acid sequence from region 1-355.

Product Specifications

Product Name Alternative

Protein ATP1B4, X, K-ATPase subunit beta-m, X/potassium-transporting ATPase subunit beta-m

UniProt

Q9BDK6

Expression Region

1-355

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRRQLRSRRAPAFPYGYGYRLDDQDEVNQNYLADEEEEAEEARVMVVPDLEEEEKEEEEE KEEDEKEEEESHHQDTRSAWWQKLQIVNEYLWDPEKRMSLARTGQSLSLLLVIYFFFYAS LAAVITLCMYTLFLTISPYVPTFTERVKPPGVMIRPFAHSLNFNFNVSEPDTWQHYVISL NGFLQGYNDSLQEEMNVDCPPGQYFIQDGDEDEDKKACQFKRSFLKNCSGLEDPTFGYST GQPCILLKMNRIVGFRPELGDPVKVSCKVQRGDENDIRSISYYPESASFDLRYYPYYGKL THVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGIINDVINDRFVGRVIFTLNIET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vatalanib (PTK787) 2HCl
A1778-10 10 mg

Vatalanib (PTK787) 2HCl

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Rabbit IgA Secondary Antibody [Allophycocyanin]
NBP2-68338APC 1 mL

Goat Polyclonal Goat anti-Rabbit IgA Secondary Antibody [Allophycocyanin]

Sign In for Pricing
View Details
pTH-Related Protein (1-34) (human, mouse, rat)
4017147.05 0.5 mg

pTH-Related Protein (1-34) (human, mouse, rat)

Sign In for Pricing
View Details
DUXAP10 sgRNA CRISPR Lentivector (Human) (Target 3)
K0642104 1.0 µg DNA

DUXAP10 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Pasteurella multocida Uncharacterized protein PM0901 (PM0901), partial
MBS1350751-01 0.5 mg (E-Coli)

Recombinant Pasteurella multocida Uncharacterized protein PM0901 (PM0901), partial

Sign In for Pricing
View Details
Recombinant Pasteurella multocida Uncharacterized protein PM0901 (PM0901), partial
MBS1350751-02 0.05 mg (Baculovirus)

Recombinant Pasteurella multocida Uncharacterized protein PM0901 (PM0901), partial

Sign In for Pricing
View Details