Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Protein ATP1B4 (ATP1B4)

This Recombinant Bovine Protein ATP1B4 (ATP1B4) spans the amino acid sequence from region 1-355.

Product Specifications

Product Name Alternative

Protein ATP1B4, X, K-ATPase subunit beta-m, X/potassium-transporting ATPase subunit beta-m

UniProt

A7MB71

Expression Region

1-355

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRRQLRSRRAPALPYGYRYRLDDQDEVNQNYLADEEEEAEEEARVMVVPDLEEEEEEEEE KEEEEKEEEDSHSQETDSAWWRKLQIVNEYLWDPEKRTSLARTGQSWSLILVIYFFFYAS LAAVITLCMYTLFLTISPYMPTFTERVKPPGVMIRPFAHSLNFNFNVSEPDTWQHYVISL NGFLQGYNDSLQEEMNVDCPPGQYFIQDGDEDEDKKACQFKRSFLKNCSGLEDPTFGYST GQPCILLKMNRIVGFRPERGDPVKVSCKVQRGDENDIRSINYYPESASFDLRYYPYYGKL THVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGIINDVINDRFVGRVIFTLNIET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF740 conjugate, 0.1mg/mL
BNC740851-100 1x 100 µL

HSP60 (LK1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL
BNC470008-100 1x 100 µL

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (500000000000), CF488A conjugate, 0.1mg/mL
BNC882624-500 1x 500 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (500000000000), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), CF740 conjugate, 0.1mg/mL
BNC741373-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (CIP1/823), CF405S conjugate, 0.1mg/mL
BNC040823-100 1x 100 µL

P21 / WAF1 (CIP1/823), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (rTGB24), CF405S conjugate, 0.1mg/mL
BNC041967-500 1x 500 µL

Thyroglobulin (Thyroidal Cell Marker) (rTGB24), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details