Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Blood vessel epicardial substance (Bves)

This Recombinant Rat Blood vessel epicardial substance (Bves) spans the amino acid sequence from region 1-356.

Product Specifications

Product Name Alternative

Blood vessel epicardial substance, Popeye domain-containing protein 1, Popeye protein 1

UniProt

Q3BCU4

Expression Region

1-356

Origin

Rattus norvegicus (Rat)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFTEPSPLAQSTVVGFLPELESLTPVPSNETSCENWREVHHLVFHAANVCFAVGLLIPT TLHLHMILLRVMLSIGCTLYVVWATLYRCALDMMIWNSVFLGINILHLSYLLYKKRPVKI EKDLGGVYHRLFEPLRVPPDLFRRLTGQFCVIQTLKRGQVYATEDKTSVDDRLSILLKGR MKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIVADDNCRFLCWSRERLTYFLE SEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKVKKLEPQMSLSTQISMLEMRNSITSSS DIEDGLHHFLRGSSSTASLPMSSPQQRASPKMKPIEEGLEDDDEVFVPVSPAHQLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL
BNC470096-100 1x 100 µL

Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL
BNC740437-100 1x 100 µL

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
BNC880009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF647 conjugate, 0.1mg/mL
BNC470305-100 1x 100 µL

CD95 (B-R18), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details