Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Protein ATP1B4 (Atp1b4)

This Recombinant Rat Protein ATP1B4 (Atp1b4) spans the amino acid sequence from region 1-356.

Product Specifications

Product Name Alternative

Protein ATP1B4, X, K-ATPase subunit beta-m, X/potassium-transporting ATPase subunit beta-m

UniProt

Q9R193

Expression Region

1-356

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRRQLRSRRAPAFPYGYRYRLDDQDEMNHNYLADEEEEAEEEAQVMMVPGLEEEEEEEEG KEEEEEREEEEGQGQSTGNAWWRKLQIVNEYLWDPEKRMSLARTGQSRSLILVIYFFFYA SLAAVITLFIYMLFLAISPYMPTFTEQVKPPGVMIRPFAHSLNFNFNVSEPETWQRYVIS LNGFLQGYNDSLQEEMNIDCPPGQYFIQDGDEDEDKKACQFKRSFLKNCSGLEDPTFGYS TGQPCILLKMNRIVGFRPEFGDPVKVSCKVQKGDENDIRSINYYPESASFDLRYYPYYGK LTHVNYTSPLVAMHFTDVVKNQEVPVQCQLKGKGIVNDVINDRFVGRIIFTLNIET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diphenoxylate N-Oxide
TRC-D585620-25MG 25 mg

Diphenoxylate N-Oxide

Sign In for Pricing
View Details
GNG2 (NM_053064) Human Over-expression Lysate
LY403285 100 µg

GNG2 (NM_053064) Human Over-expression Lysate

Sign In for Pricing
View Details
C9orf25 (FAM219A) (NM_001184945) Human Over-expression Lysate
LC432602 20 µg

C9orf25 (FAM219A) (NM_001184945) Human Over-expression Lysate

Sign In for Pricing
View Details
COL18A1 Polyclonal Antibody
E-AB-70197-01 60 µL

COL18A1 Polyclonal Antibody

Sign In for Pricing
View Details
COL18A1 Polyclonal Antibody
E-AB-70197-02 120 µL

COL18A1 Polyclonal Antibody

Sign In for Pricing
View Details
COL18A1 Polyclonal Antibody
E-AB-70197-03 200 µL

COL18A1 Polyclonal Antibody

Sign In for Pricing
View Details