Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 2 UPF0283 membrane protein BMEA_A1074 (BMEA_A1074)

This Recombinant Brucella melitensis biotype 2 UPF0283 membrane protein BMEA_A1074 (BMEA_A1074) spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

UPF0283 membrane protein BMEA_A1074

UniProt

C0RJ08

Expression Region

1-357

Origin

Brucella melitensis biotype 2 (strain ATCC 23457)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDKTPRKPTAFRLEQPARVSAASEQEEPRRPRAVKDLEQITPQADVFDLTDDEAAELEI LDPAFEAPERKGWSLSRILFGALGILVSFAIGIWTEDLIRALFARADWLGWTALGVAMVA LAAFAAIILRELVALRRLASVQHLRKDAADAAERDDMAAARKAVDALRTIAAGIPETAKG RQLLESLTDDIIDGRDLIRLAETEILRPLDREARTLVLNASKRVSIVTAISPRALVDIGY VIFESARLIRRLSQLYGGRPGTLGFIKFARRVIAHLAVTGTIAMGDSVMQQLVGHGLASR LSAKLGEGVVNGLMTARIGIAAMDVVRPFPFNAEKRPGIGDFIGDLARLNSDRNARK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
14764064 1.0 µg DNA

C9 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
BIP3 Antibody
orb790280 2 mg

BIP3 Antibody

Sign In for Pricing
View Details
Interleukin 31 (IL-31) (MaxLight 405)
MBS6483275-01 0.1 mL

Interleukin 31 (IL-31) (MaxLight 405)

Sign In for Pricing
View Details
Interleukin 31 (IL-31) (MaxLight 405)
MBS6483275-02 5x 0.1 mL

Interleukin 31 (IL-31) (MaxLight 405)

Sign In for Pricing
View Details
Mouse Monoclonal SIRP alpha/CD172a Antibody (OX-41) [FITC]
NB100-65530F 0.25 mL

Mouse Monoclonal SIRP alpha/CD172a Antibody (OX-41) [FITC]

Sign In for Pricing
View Details
Anti-Mouse LPAM-1 (Integrin beta4beta7)-UNLB Antibody
MBS4151927-01 0.1 mg

Anti-Mouse LPAM-1 (Integrin beta4beta7)-UNLB Antibody

Sign In for Pricing
View Details