Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 2 UPF0283 membrane protein BMEA_A1074 (BMEA_A1074)

This Recombinant Brucella melitensis biotype 2 UPF0283 membrane protein BMEA_A1074 (BMEA_A1074) spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

UPF0283 membrane protein BMEA_A1074

UniProt

C0RJ08

Expression Region

1-357

Origin

Brucella melitensis biotype 2 (strain ATCC 23457)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDKTPRKPTAFRLEQPARVSAASEQEEPRRPRAVKDLEQITPQADVFDLTDDEAAELEI LDPAFEAPERKGWSLSRILFGALGILVSFAIGIWTEDLIRALFARADWLGWTALGVAMVA LAAFAAIILRELVALRRLASVQHLRKDAADAAERDDMAAARKAVDALRTIAAGIPETAKG RQLLESLTDDIIDGRDLIRLAETEILRPLDREARTLVLNASKRVSIVTAISPRALVDIGY VIFESARLIRRLSQLYGGRPGTLGFIKFARRVIAHLAVTGTIAMGDSVMQQLVGHGLASR LSAKLGEGVVNGLMTARIGIAAMDVVRPFPFNAEKRPGIGDFIGDLARLNSDRNARK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Human CD8a (OKT8)
MBS4165385-01 100 Tests

FITC Anti-Human CD8a (OKT8)

Sign In for Pricing
View Details
FITC Anti-Human CD8a (OKT8)
MBS4165385-02 5x 100 Tests

FITC Anti-Human CD8a (OKT8)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Polyketide biosynthesis cytochrome P450 PksS (pksS)
orb2925212-01 20 µg

Recombinant Bacillus subtilis Polyketide biosynthesis cytochrome P450 PksS (pksS)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Polyketide biosynthesis cytochrome P450 PksS (pksS)
orb2925212-02 100 µg

Recombinant Bacillus subtilis Polyketide biosynthesis cytochrome P450 PksS (pksS)

Sign In for Pricing
View Details
Recombinant Human CD325 protein, C-His Tag
MBS1560644-01 0.05 mg

Recombinant Human CD325 protein, C-His Tag

Sign In for Pricing
View Details
Recombinant Human CD325 protein, C-His Tag
MBS1560644-02 0.1 mg

Recombinant Human CD325 protein, C-His Tag

Sign In for Pricing
View Details