Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum SrfA-induced gene J protein (sigJ)

This Recombinant Dictyostelium discoideum SrfA-induced gene J protein (sigJ) spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

SrfA-induced gene J protein

UniProt

Q6TMJ3

Expression Region

1-357

Origin

Dictyostelium discoideum (Slime mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRVEDQIKDNYNSLSHEGERLNREAKIESEKLKNNAKLDAKDMKKDIDESVHSSWETVK EGAKTVQDYISSGIESVKHTITTEPAQKDMENLKHNVNHNLEEAEKEGSSVLNNISNFFK GSAEEAKSEAERIGYEAYKDGDQFVGDVHKNFKRTANETQKDANRLTSDVKNESNKIYKD IKDESNKLYNDVKGESSKIYNGAKKEGSKLATDLKKDTQYVADETKKMAADLKNKAADTY QDLSHDASKKATQLKKKASETLDESADAIEHQFDIMKKDFRHLNQRNGMIWGSIGLIGGA TATSYLFPSASPMAKFTFIAGLASLGGYYGLHQPHNKIVDNAFHKANNKKEELKKKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL
BNC472853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF488A conjugate, 0.1mg/mL
BNC880193-100 1x 100 µL

CD86 (BU63), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-500 1x 500 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL
BNC470745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 1 (Suprabasal Keratinocyte Marker) (LHK1), CF405S conjugate, 0.1mg/mL
BNC041660-100 1x 100 µL

Cytokeratin 1 (Suprabasal Keratinocyte Marker) (LHK1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Smooth Muscle Actin (ACTA2/791 +1A4), CF647 conjugate, 0.1mg/mL
BNC471203-500 1x 500 µL

Smooth Muscle Actin (ACTA2/791 +1A4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details