Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein FAM118A (Fam118a)

This Recombinant Mouse Protein FAM118A (Fam118a) spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

Protein FAM118A

UniProt

Q91YN1

Expression Region

1-357

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESVEKTTNRSEQKCRKFLKSLIRKQPQDLLLVIGTGVSAAVAPGIRALCSWRSCIEAVI EAAEQLEVLHPGDVAEFRRKVMKDRDLLVVAHDLIRKMSPRTGDTKPNFFQDCLMEVFDS LEQHIQNPVVLRSILSLMDRGTMVLTTNYDNLLEIFGQQQSKPMESLDLKDKTKVLQWAR GHIKYGVLHIHGLYTDPCGMVLDPSGYKDVTQDPEVMEVLQNLYRTKSFLFVGCGETLRD QIFQALFLYSVPNKVDLEHYMVVLKENEDHFFKHQADMLLHGIKVVSYGDCFDLFPGYVQ DLATQICKQRSPDAERVDSTTLLGNACQDCAKRKLEENGIEVTKKVRQSDTDDAGGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
BNC040158-500 1x 500 µL

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
BNC040096-100 1x 100 µL

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF640R conjugate, 0.1mg/mL
BNC400164-500 1x 500 µL

CD28 (204.12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF640R conjugate, 0.1mg/mL
BNC400333-100 1x 100 µL

CD8 (RIV11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL
BNC400391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL
BNC402853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details