Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Guinea pig T-cell surface glycoprotein CD1e, membrane-associated (CD1E)

This Recombinant Guinea pig T-cell surface glycoprotein CD1e, membrane-associated (CD1E) spans the amino acid sequence from region 34-390.

Product Specifications

Product Name Alternative

T-cell surface glycoprotein CD1e, membrane-associated, mCD1e, CD_antigen= CD1e, Cleaved into the following chain:, 1. T-cell surface glycoprotein CD1e, soluble, 2. sCD1

UniProt

Q9QZY5

Expression Region

34-390

Origin

Cavia porcellus (Guinea pig)

Field of Research

Neuroscience; Immunology & Inflammation; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EEPLIFRLLHIASFKNHSWSHSQASAWIGDLQTHGWNSTMGTIQFLKPWSQGDFSKEELK NFEALFRLYFHDFPREVHAFAHQFQFEYPFELQISGGCKNVGKTSENFLNGAYQGSDLLS FQRSSWEPSPGAGSRAQKVCEVLSYYKDITEIVQSLLSSVCPRFLSGLIAAGKSELERQV KPEVWLSRGPSPGRGRLQLVCHVSGFHPKPVWVMWMKGQQEQKGTKTGDIPNADETWYLQ ATLDVAEREATGLSCRVKHSSLGGHDIIIHWGGYSILLILMYVAVIVTLVTLIVMGSWHR KQSSNRNVLSSYISNPTFPLENDTQCPRSSALQLHSAQESWIKNRILKWKRSLNQFW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PmL Protein (PmL) Human Gene Knockout Kit (CRISPR)
KN200700 1 Kit

PmL Protein (PmL) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CF®647 Free Acid
#92062 1x 1 mg

CF®647 Free Acid

Sign In for Pricing
View Details
Recombinant Human NECTIN4 Protein (Sumo Tag)
PDEH100662-01 20 µg

Recombinant Human NECTIN4 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human NECTIN4 Protein (Sumo Tag)
PDEH100662-02 100 µg

Recombinant Human NECTIN4 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human NECTIN4 Protein (Sumo Tag)
PDEH100662-03 500 µg

Recombinant Human NECTIN4 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human NECTIN4 Protein (Sumo Tag)
PDEH100662-04 1 mg

Recombinant Human NECTIN4 Protein (Sumo Tag)

Sign In for Pricing
View Details