Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein ATP1B4 (ATP1B4)

This Recombinant Human Protein ATP1B4 (ATP1B4) spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

Protein ATP1B4, X, K-ATPase subunit beta-m, X/potassium-transporting ATPase subunit beta-m

UniProt

Q9UN42

Expression Region

1-357

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRRQLRSRRAPSFPYSYRYRLDDPDEANQNYLADEEEEAEEEARVTVVPKSEEEEEEEEK EEEEEEEKEEEEGQGQPTGNAWWQKLQIMSEYLWDPERRMFLARTGQSWSLILLIYFFFY ASLAAVITLCMYTLFLTISPYIPTFTERVKPPGVMIRPFAHSLNFNFNVSEPDTWQHYVI SLNGFLQGYNDSLQEEMNVDCPPGQYFIQDGNEDEDKKACQFKRSFLKNCSGLEDPTFGY STGQPCILLKMNRIVGFRPELGDPVKVSCKVQRGDENDIRSISYYPESASFDLRYYPYYG KLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGVINDVINDRFVGRVIFTLNIET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EK (Eepidermal Keratin) BioAssayTM ELISA Kit (Human) discontinued
355411-01 48 Tests

EK (Eepidermal Keratin) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
EK (Eepidermal Keratin) BioAssayTM ELISA Kit (Human) discontinued
355411-02 96 Tests

EK (Eepidermal Keratin) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
FRA9A Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV725878 1.0 µg DNA

FRA9A Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Mouse Olfr368 (NM_146374) AAV Particle
MR212633A1V 250 µL

Mouse Olfr368 (NM_146374) AAV Particle

Sign In for Pricing
View Details
Potassium Ferricyanide Printing grade 97.0%
029610-01 25 Kg

Potassium Ferricyanide Printing grade 97.0%

Sign In for Pricing
View Details
Potassium Ferricyanide Printing grade 97.0%
029610-02 50 Kg

Potassium Ferricyanide Printing grade 97.0%

Sign In for Pricing
View Details