Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ganglioside-induced differentiation-associated protein 1 (Gdap1)

This Recombinant Mouse Ganglioside-induced differentiation-associated protein 1 (Gdap1) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

Ganglioside-induced differentiation-associated protein 1, GDAP1

UniProt

O88741

Expression Region

1-358

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MARRQDEARAGVPLRVEGPPDKEVHLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPL SEHNEPWFMRLNSAGEVPVLVHGENIICEATQIIDYLEQTFLDERTPRLMPDEGSMYYPR VQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPD LQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGNQPWLC GESFTLADVSLAVTLHRLKFLGFARRNWGHGKRPNLETYYERVLKRKTFNKVLGHVNNIL ISAVLPTAFRVAKKRAPKVLGSTLVVGLLVGMGYFAFMLFRRRLGSMILALRPRPNYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant HMGCL Antibody
RC-4675-01 50 μL

Recombinant HMGCL Antibody

Sign In for Pricing
View Details
Recombinant HMGCL Antibody
RC-4675-02 100 µL

Recombinant HMGCL Antibody

Sign In for Pricing
View Details
Recombinant HMGCL Antibody
RC-4675-03 1 mL

Recombinant HMGCL Antibody

Sign In for Pricing
View Details
Recombinant Collagen X alpha 1 Antibody
RC-16889-01 50 μL

Recombinant Collagen X alpha 1 Antibody

Sign In for Pricing
View Details
Recombinant Collagen X alpha 1 Antibody
RC-16889-02 100 µL

Recombinant Collagen X alpha 1 Antibody

Sign In for Pricing
View Details
Recombinant Collagen X alpha 1 Antibody
RC-16889-03 1 mL

Recombinant Collagen X alpha 1 Antibody

Sign In for Pricing
View Details