Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Epoxide hydrolase 4 (Ephx4)

This Recombinant Mouse Epoxide hydrolase 4 (Ephx4) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Epoxide hydrolase 4, EC= 3.3.-.-, Abhydrolase domain-containing protein 7, Epoxide hydrolase-related protein

UniProt

Q6IE26

Expression Region

1-359

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPPRPPRLLPALRALLYWSLVYGYCGLCASVHLLKLLWSIGRAPAQTFRRAARANPPAC LNDPSLGTHCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRHQLREFKSEYRV VALDLRGYGESDAPAHQESYKLDCLIADIKDILDSLGYSKCVLIGHDWGGMIAWLIAVCY PEMIMKLIVINFPHPSVFTEYILRHPAQLFRSSFYYFFQIPRFPEFMFSINDFKVLKHLF TSQSTGIGRKGRQLTTEDLEAYVYVFSQPGALSGPINHYRNIFSCLPLKHHMVTTPTLLL WGEEDAFMEVEMAEVTKIYVKNYFRLTILSEGSHWLQQDQPDIVNGLIWAFLKEETRRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Chloro-1-methoxy-3-methylbenzene
OR1094867 1 Each

2-Chloro-1-methoxy-3-methylbenzene

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain JAY291)(Baker's yeast) RTC5 Polyclonal Antibody
MBS7178738 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain JAY291)(Baker's yeast) RTC5 Polyclonal Antibody

Sign In for Pricing
View Details
MAPK6 Antibody
CSB-PA013458GA01HU 100 µL

MAPK6 Antibody

Sign In for Pricing
View Details
Lentiviral human EPHA2 shRNA (UAS) - Lentiviral human EPHA2 shRNA (UAS) (100)
GTR15084318 1 Vial

Lentiviral human EPHA2 shRNA (UAS) - Lentiviral human EPHA2 shRNA (UAS) (100)

Sign In for Pricing
View Details
PathScan® RP G4S Linker/CD3ζ CAR Sandwich ELISA Kit
CST 20418V4 50 Kits

PathScan® RP G4S Linker/CD3ζ CAR Sandwich ELISA Kit

Sign In for Pricing
View Details
Human Rab GTPase-binding effector protein 1, RABEP1 ELISA Kit
MBS9324047-01 48 Well

Human Rab GTPase-binding effector protein 1, RABEP1 ELISA Kit

Sign In for Pricing
View Details