Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Epoxide hydrolase 4 (Ephx4)

This Recombinant Mouse Epoxide hydrolase 4 (Ephx4) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Epoxide hydrolase 4, EC= 3.3.-.-, Abhydrolase domain-containing protein 7, Epoxide hydrolase-related protein

UniProt

Q6IE26

Expression Region

1-359

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPPRPPRLLPALRALLYWSLVYGYCGLCASVHLLKLLWSIGRAPAQTFRRAARANPPAC LNDPSLGTHCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRHQLREFKSEYRV VALDLRGYGESDAPAHQESYKLDCLIADIKDILDSLGYSKCVLIGHDWGGMIAWLIAVCY PEMIMKLIVINFPHPSVFTEYILRHPAQLFRSSFYYFFQIPRFPEFMFSINDFKVLKHLF TSQSTGIGRKGRQLTTEDLEAYVYVFSQPGALSGPINHYRNIFSCLPLKHHMVTTPTLLL WGEEDAFMEVEMAEVTKIYVKNYFRLTILSEGSHWLQQDQPDIVNGLIWAFLKEETRRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAC3 sgRNA CRISPR Lentivector (Human) (Target 3)
K2326004 1.0 µg DNA

TAC3 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Serpinb9e AAV siRNA Pooled Vector
43494166 1.0 µg

Serpinb9e AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Lentiviral mouse R3hcc1l shRNA (UAS) - Lentiviral mouse R3hcc1l shRNA (UAS) (25)
GTR15216197 1 Vial

Lentiviral mouse R3hcc1l shRNA (UAS) - Lentiviral mouse R3hcc1l shRNA (UAS) (25)

Sign In for Pricing
View Details
Human PRPS1 Recombinant Protein
PPT-14766 100 µg

Human PRPS1 Recombinant Protein

Sign In for Pricing
View Details
MMP8 Antibody
CSB-PA010208-01 50 µg

MMP8 Antibody

Sign In for Pricing
View Details
MMP8 Antibody
CSB-PA010208-02 100 µg

MMP8 Antibody

Sign In for Pricing
View Details