Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative peroxisome assembly protein 12 (prx-12)

This Recombinant Putative peroxisome assembly protein 12 (prx-12) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Putative peroxisome assembly protein 12, Peroxin-12

UniProt

Q19189

Expression Region

1-359

Origin

Caenorhabditis elegans

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTTIRASQLASSISPKTEEKQPSVFDIIAQENLATSIRPALQHLVKYLAFFKPKTFLSV HRNFDEYYIIFDLILQNHYLRNYGASFTENFYSMKRIASGTGNPPNDGRERIMSLITLVG WPYVENKLNQLYDRLKEVYECRSWSSINGMKAKCQKMFVIIWPYIKTALKAVKSALQLAY ILNRSSIHSPWLYFSGVILKHLTPEDLEAFNAVPLHLQTGYQISRGTLNEHIHLRFFNRI WRFILGLPGIVSRLFAYGLFFVQFLDYMYNTDLAKLTKTGLDGAIPSPPHKMIISESEIL SLDTNKCPICLKKRVNDTALFVSGYVFCYTCINQYVNTYNKCPVTGCPANVQHLIRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), CF594 conjugate, 0.1mg/mL
BNC941864-100 1x 100 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human DDX47 activation kit by CRISPRa
GA109646 1 Kit

Human DDX47 activation kit by CRISPRa

Sign In for Pricing
View Details
CD59 Antibody (Biotin)
KB-27080-01 50 μL

CD59 Antibody (Biotin)

Sign In for Pricing
View Details
CD59 Antibody (Biotin)
KB-27080-02 100 µL

CD59 Antibody (Biotin)

Sign In for Pricing
View Details
CD59 Antibody (Biotin)
KB-27080-03 1 mL

CD59 Antibody (Biotin)

Sign In for Pricing
View Details
Human HS6ST2 activation kit by CRISPRa
GA113983 1 Kit

Human HS6ST2 activation kit by CRISPRa

Sign In for Pricing
View Details