Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Peroxisome assembly protein 12 (Pex12)

This Recombinant Mouse Peroxisome assembly protein 12 (Pex12) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Peroxisome assembly protein 12, Peroxin-12

UniProt

Q8VC48

Expression Region

1-359

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEYGAHITTASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPAHYGFLWRWFD EIFTLLDFLLQQHYLSRTSASFSEHFYGLKRIVAGSSPHLQRPASAGLPKEHLWKSAMFL VLLPYLKVKLEKLASSLREEDEYSIHPPSSRWKRFYRAFLAAYPFVNMAWEGWFLTQQLR YILGKAEHHSPLLKLAGVRLARLTAQDMQAIKQRLVEASAMQEPVRSVGEKIKSALKKAV GGVALSLSTGLSVGVFFLQFLDWWYSSENQEAIKSLTALPTPPPPVHLDYNSDSPLLPKM KTVCPLCRKTRVNDTVLATSGYVFCYRCVFNYVRSHQACPITGYPTEVQHLIKLYSPEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AATF (Apoptosis Antagonizing Transcription Factor, CHE1, CHE-1, DED, HSPC277, Protein AATF, Rb-binding Protein Che-1) (APC)
122788-APC 100 µL

AATF (Apoptosis Antagonizing Transcription Factor, CHE1, CHE-1, DED, HSPC277, Protein AATF, Rb-binding Protein Che-1) (APC)

Sign In for Pricing
View Details
Mouse Polyclonal HBS1L Antibody
H00010767-B01P 0.05 mg

Mouse Polyclonal HBS1L Antibody

Sign In for Pricing
View Details
Recombinant Bovine Syntaxin-1A (STX1A)
MBS953426 Inquire

Recombinant Bovine Syntaxin-1A (STX1A)

Sign In for Pricing
View Details
CPLX1 Antibody - middle region
OAAB06005-400UL 400 µL

CPLX1 Antibody - middle region

Sign In for Pricing
View Details
Growth hormone receptor Rabbit Monoclonal Antibody (Detector)
E56PA0532 100 µL

Growth hormone receptor Rabbit Monoclonal Antibody (Detector)

Sign In for Pricing
View Details
EXOSC7 Recombinant Antibody, PE Conjugated
bsm-61929R-PE-01 20 µL

EXOSC7 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details