Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peroxisome assembly protein 12 (PEX12)

This Recombinant Human Peroxisome assembly protein 12 (PEX12) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Peroxisome assembly protein 12, Peroxin-12, Peroxisome assembly factor 3, PAF-3

UniProt

O00623

Expression Region

1-359

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEHGAHFTAASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPTHYGFLWRWFD EIFTLLDLLLQQHYLSRTSASFSENFYGLKRIVMGDTHKSQRLASAGLPKQQLWKSIMFL VLLPYLKVKLEKLVSSLREEDEYSIHPPSSRWKRFYRAFLAAYPFVNMAWEGWFLVQQLR YILGKAQHHSPLLRLAGVQLGRLTVQDIQALEHKPAKASMMQQPARSVSEKINSALKKAV GGVALSLSTGLSVGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKM KTVCPLCRKTRVNDTVLATSGYVFCYRCVFHYVRSHQACPITGYPTEVQHLIKLYSPEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DR3/TNFRSF25 Recombinant Rabbit monoclonal Antibody
HA723871B 100 µL

Human DR3/TNFRSF25 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Anti-Mouse CD8 (YTS-169) In Vivo Antibody - Ultra-Low Endotoxin
ICH1043UL-25mg 25 mg

Anti-Mouse CD8 (YTS-169) In Vivo Antibody - Ultra-Low Endotoxin

Sign In for Pricing
View Details
TRPA1 Rabbit Polyclonal Antibody
ER1803-91 100 µL

TRPA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Gdpd3 activation kit by CRISPRa
GA207873 1 Kit

Mouse Gdpd3 activation kit by CRISPRa

Sign In for Pricing
View Details
Bulk Beads, Silica (glass), 0.5mm, acid washed, 200g
D1131-05 1 Each

Bulk Beads, Silica (glass), 0.5mm, acid washed, 200g

Sign In for Pricing
View Details
RBFOX3 Polyclonal Antibody
E-AB-70267-01 60 µL

RBFOX3 Polyclonal Antibody

Sign In for Pricing
View Details