Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peroxisome assembly protein 12 (PEX12)

This Recombinant Human Peroxisome assembly protein 12 (PEX12) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Peroxisome assembly protein 12, Peroxin-12, Peroxisome assembly factor 3, PAF-3

UniProt

O00623

Expression Region

1-359

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEHGAHFTAASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPTHYGFLWRWFD EIFTLLDLLLQQHYLSRTSASFSENFYGLKRIVMGDTHKSQRLASAGLPKQQLWKSIMFL VLLPYLKVKLEKLVSSLREEDEYSIHPPSSRWKRFYRAFLAAYPFVNMAWEGWFLVQQLR YILGKAQHHSPLLRLAGVQLGRLTVQDIQALEHKPAKASMMQQPARSVSEKINSALKKAV GGVALSLSTGLSVGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKM KTVCPLCRKTRVNDTVLATSGYVFCYRCVFHYVRSHQACPITGYPTEVQHLIKLYSPEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOMER1 Mouse Monoclonal Antibody [Clone ID: AT1F3]
AM09075PU-N 100 µL

HOMER1 Mouse Monoclonal Antibody [Clone ID: AT1F3]

Sign In for Pricing
View Details
KCNIP2 Rabbit Polyclonal Antibody
HA500491 100 µL

KCNIP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FNDC3B Polyclonal Antibody
E-AB-52260-01 20 µL

FNDC3B Polyclonal Antibody

Sign In for Pricing
View Details
FNDC3B Polyclonal Antibody
E-AB-52260-02 60 µL

FNDC3B Polyclonal Antibody

Sign In for Pricing
View Details
FNDC3B Polyclonal Antibody
E-AB-52260-03 120 µL

FNDC3B Polyclonal Antibody

Sign In for Pricing
View Details
FNDC3B Polyclonal Antibody
E-AB-52260-04 200 µL

FNDC3B Polyclonal Antibody

Sign In for Pricing
View Details