Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Peroxisome assembly protein 12 (Pex12)

This Recombinant Rat Peroxisome assembly protein 12 (Pex12) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Peroxisome assembly protein 12, Peroxin-12, Peroxisome assembly factor 3, PAF-3

UniProt

O88177

Expression Region

1-359

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEHGAHITTASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPAHYGFFWRWFD EIFTLLDFLLQQHYLSRTSASFSEHFYGLKRIVAGSSPQLQRPASAGLPKEHLWKSAMFL VLLPYLKVKLEKLASTLREEDEYSIHPPSSHWKRFYRVFLAAYPFVTMTWEGWFLTQQLR YILGKAEHHSPLLKLAGVRLGRLTAQDIQAMEHRLVEASAMQEPVRSIGKKIKSALKKAV GGVALSLSTGLSVGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKM KTVCPLCRKARVNDTVLATSGYVFCYRCVFNYVRSHQACPITGYPTEVQHLIKLYSPEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal RYBP/DEDAF Antibody (OTI1B2) [FITC]
NBP2-73961F 0.1 mL

Mouse Monoclonal RYBP/DEDAF Antibody (OTI1B2) [FITC]

Sign In for Pricing
View Details
Human Vesicle-Associated Membrane Protein 2 (VAMP2) ELISA Kit
MBS9713742-01 48 Tests

Human Vesicle-Associated Membrane Protein 2 (VAMP2) ELISA Kit

Sign In for Pricing
View Details
Human Vesicle-Associated Membrane Protein 2 (VAMP2) ELISA Kit
MBS9713742-02 96 Tests

Human Vesicle-Associated Membrane Protein 2 (VAMP2) ELISA Kit

Sign In for Pricing
View Details
Human Vesicle-Associated Membrane Protein 2 (VAMP2) ELISA Kit
MBS9713742-03 5x 96 Tests

Human Vesicle-Associated Membrane Protein 2 (VAMP2) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody (04) [Janelia Fluor 549]
NBP3-06551JF549 0.1 mL

Mouse Monoclonal gamma-Glutamylcyclotransferase/CRF21/GGCT Antibody (04) [Janelia Fluor 549]

Sign In for Pricing
View Details
HP1-β (Phospho Thr51) Antibody
A9091-01 50 μL

HP1-β (Phospho Thr51) Antibody

Sign In for Pricing
View Details