Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Armadillo repeat-containing X-linked protein 4 (ARMCX4)

This Recombinant Human Armadillo repeat-containing X-linked protein 4 (ARMCX4) spans the amino acid sequence from region 1-360.

Product Specifications

Product Name Alternative

Armadillo repeat-containing X-linked protein 4

UniProt

Q5H9R4

Expression Region

1-360

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAAGLKITGSKETKRRLLLISIDWSRDLMNLCIYFRVYCQEKQEERRELPRIITGPPPE AAVVAFEWLKTSTLTGLHPQLPLSLPQPECALPYLVRAFSRGDYMGRIQEVGWVTAGLVI WAGTCYYIYKFTKGRAQSVRTLARNGSTVKMETVVGVQSQTLAINEAEIKTKPQVEIGAE TGARSGPRAEVETKATAIAIHRANSQAKAMVGAEPETQSESKVVAGTLVMTEAVTLTEVK AKAREVAMKEAVTQTDAEAGKIVKKEAVTQTKAKAWALVAKTEAKREAMTQTKAETHILA EKETEINRVMVTQSETLAVPREVAKMGATNKTGIVDETKTRALEETVLIPRAFPSKNASC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA Antibody
E55A11981 100 µg

DNA Antibody

Sign In for Pricing
View Details
Dtd1 3'UTR Luciferase Stable Cell Line
TU105418 1.0 mL

Dtd1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Enterobacter sakazakii DNA Fluorescence PCR Detection Kit
BSB10M1 48 Tests

Enterobacter sakazakii DNA Fluorescence PCR Detection Kit

Sign In for Pricing
View Details
TBRG1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-4268R-BF680 100 µL

TBRG1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
PRMT4 Antibody
F41369-0.4ML 0.4 mL

PRMT4 Antibody

Sign In for Pricing
View Details
FBXO4, ID (FBXO4, FBX4, F-box only protein 4) (AP) discontinued
035561-AP 200 µL

FBXO4, ID (FBXO4, FBX4, F-box only protein 4) (AP) discontinued

Sign In for Pricing
View Details