Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Cell cycle control protein 50A (TMEM30A)

This Recombinant Pongo abelii Cell cycle control protein 50A (TMEM30A) spans the amino acid sequence from region 2-361.

Product Specifications

Product Name Alternative

Cell cycle control protein 50A, Transmembrane protein 30A

UniProt

Q5R6C0

Expression Region

2-361

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AMNYNAKDEVDGGPPCAPGGSAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIF IPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCICTINFTLEKSFEGNVFMY YGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFND TLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLKERFKGTTKPVNWLKPVY MLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYPV HYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKYRNSSNTADITI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB20 (NM_001164347) Human Over-expression Lysate
LC432019 20 µg

ZBTB20 (NM_001164347) Human Over-expression Lysate

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/2338R), CF647 conjugate, 0.1mg/mL
BNC472338-100 1x 100 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/2338R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C3 Antibody
KC-2252-01 50 μL

C3 Antibody

Sign In for Pricing
View Details
C3 Antibody
KC-2252-02 100 µL

C3 Antibody

Sign In for Pricing
View Details
C3 Antibody
KC-2252-03 1 mL

C3 Antibody

Sign In for Pricing
View Details
Porcine Interleukin 5 (IL5) ELISA Kit
RD-IL5-p-01 96 Tests

Porcine Interleukin 5 (IL5) ELISA Kit

Sign In for Pricing
View Details