Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Inward rectifier potassium channel 13 (Kcnj13)

This Recombinant Mouse Inward rectifier potassium channel 13 (Kcnj13) spans the amino acid sequence from region 1-360.

Product Specifications

Product Name Alternative

Inward rectifier potassium channel 13, Inward rectifier K (+) channel Kir7.1, Potassium channel, inwardly rectifying subfamily J member 13

UniProt

P86046

Expression Region

1-360

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSSNCKVNAPLLSQRHRRMVTKDGHSTLQMDGAQRGLVYLRDAWGILMDMRWRWMMLVF SASFVVHWLVFAVLWYAVAEMNGDLEIDHDVPPENHTICVKHITSFTAAFSFSLETQLTI GYGTMFPSGDCPSAIALLAIQMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDLAVVAH KDGKPNLIFQVANTRPSPLTNVRVSAVLYQERENGELYQTSVDFHLDGISSEECPFFIFP LTYYHTISPSSPLATLLQHETPPHFELVVFLSAMQEGTGEICQRRTSYLPSEIMLHHRFA ALMTRGSKGEYQVKMENFDKTVPEHPTPVVSKSPHRTDLDIHINGQSIDNFQIAETGLTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF740 conjugate, 0.1mg/mL
BNC740861-500 1x 500 µL

HSP27 (G3.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL
BNC551050-100 1x 100 µL

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL
BNC680669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL
BNC470158-100 1x 100 µL

Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (TGB/1968R), CF568 conjugate, 0.1mg/mL
BNC681968-500 1x 500 µL

Thyroglobulin (Thyroidal Cell Marker) (TGB/1968R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (rSPN/839), CF568 conjugate, 0.1mg/mL
BNC682220-100 1x 100 µL

CD43 (T-Cell Marker) (rSPN/839), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details