Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0285607 (DDB_G0285607)

This Recombinant Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0285607 (DDB_G0285607) spans the amino acid sequence from region 1-361.

Product Specifications

Product Name Alternative

Uncharacterized transmembrane protein DDB_G0285607

UniProt

Q54MY4

Expression Region

1-361

Origin

Dictyostelium discoideum (Slime mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFTSSKSVSLFETSLLKENQFQQPQQQPSSPIKPIKPILKLVVNSNKKYNNKNISNNNN NNNNNNNNVCGNINNNNELGDQSDIERSFLINNFEGSDQLTNPYYNSIDIESIIIEVYSN QFSKLNCDFQGLISSKSKILNSNNFSSDYNYNNYNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNKNNNKNNNNKPNNFIHHHHHHHHYHHYHNHHKVENLIDSHIFIGLMAFLILFILMV IGLLIYKYNLKKRVLILLEKRYQRKKKVKTSQFGDDFTSAKFSQVFPKNLNINQKNKDDG DDSSGADDLSVGGESFDGESDFEHFKEVQVVGDIDNVFFFKNNNYYYEENFDNENLINKE F

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
BNC740276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-100 1x 100 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF640R conjugate, 0.1mg/mL
BNC400342-100 1x 100 µL

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
BNC040225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF568 conjugate, 0.1mg/mL
BNC680189-500 1x 500 µL

CD74 (BU45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF405S conjugate, 0.1mg/mL
BNC042540-100 1x 100 µL

SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details