Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gibberella zeae Mitochondrial intermembrane space import and assembly protein 40 (MIA40)

This Recombinant Gibberella zeae Mitochondrial intermembrane space import and assembly protein 40 (MIA40) spans the amino acid sequence from region 30-391.

Product Specifications

Product Name Alternative

Mitochondrial intermembrane space import and assembly protein 40, Mitochondrial import inner membrane translocase TIM40

UniProt

Q4IK03

Expression Region

30-391

Origin

Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASTAPADKPRSFKGSLVRLGLAFGAVYYYNTSPIFADEAISKTVPAPAAFSDDDLPTVDS IVEEKRKQIKAKSEETAASSKTPESQQSNPQTAAADGSPAALEEEAGQQGAFNPETGEIN WDCPCLGGMADGPCGEEFKTAFSCFVFSQEEPKGMDCIDKFQGMQECFKKYPDIYGAELA DDEDGAPTPDFGDEQPSGEPTTAEVKSNGELARETKDKTAADATKFDDSQKPAESKTPAK TTSTSTDSAQKPAVDAHRDAEPKSDAETASSGSRMVQDVAIPIEKPVNDKYWQDMHKSEV QKKEVTVGITQAHDATAANEEIKHIERQEAAKKNAEKKQHESHLIVSYGFAFYGHLESRV EK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF640R conjugate, 0.1mg/mL
BNC401035-100 1x 100 µL

CD8 (C8/1035), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
BNC680257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL
BNC880460-100 1x 100 µL

CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
BNC681073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF647 conjugate, 0.1mg/mL
BNC470039-500 1x 500 µL

CD34 (ICO-115), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details