Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse E3 ubiquitin-protein ligase RNF149 (Rnf149)

This Recombinant Mouse E3 ubiquitin-protein ligase RNF149 (Rnf149) spans the amino acid sequence from region 32-394.

Product Specifications

Product Name Alternative

E3 ubiquitin-protein ligase RNF149, EC= 6.3.2.-, Goliath-related E3 ubiquitin-protein ligase 4, RING finger protein 149

UniProt

Q3U2C5

Expression Region

32-394

Origin

Mus musculus (Mouse)

Field of Research

Molecular Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GALEWYSAMVSIEYVDPQSNLTVWSVSESGRFGESSLREERQGLVGVPRAPAPAEGCAPD TRFVAPGALGNAPWVALVARGGCTFKDKVLAAARRNASAVVVYNLESNGNATEPMSHAGT GNIVVIMISYPKGREIFDLVQKGIPVKMRIEIGTRHMQEFISGQSVVFVAIAFITMMIIS LAWLIFYYIQRFLYTGSQFGSQNHRKETKKVIGQLPLHTVKHGEKGIDVDAENCAVCIEN FKVKDVIRILPCKHIFHRICIDPWLLDHRTCPMCKLDVIKALGYWGDPEDTQELPTPEAA PGRVSVGNLSVTSQDEERSESNLPSSSSSESGPHRPCLKEDAGEDTALLGAGRSEPQHGG SIC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF405M conjugate, 0.1mg/mL
BNC050322-100 1x 100 µL

CD3e (RIV9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF488A conjugate, 0.1mg/mL
BNC880630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF594 conjugate, 0.1mg/mL
BNC940333-100 1x 100 µL

CD8 (RIV11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF555 conjugate, 0.1mg/mL
BNC550645-500 1x 500 µL

FOXP3 (3G3), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), CF488A conjugate, 0.1mg/mL
BNC882993-100 1x 100 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin B1 (CCNB1/1098), CF568 conjugate, 0.1mg/mL
BNC681098-500 1x 500 µL

Cyclin B1 (CCNB1/1098), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details