Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cell cycle control protein 50A (Tmem30a)

This Recombinant Mouse Cell cycle control protein 50A (Tmem30a) spans the amino acid sequence from region 2-364.

Product Specifications

Product Name Alternative

Cell cycle control protein 50A, Transmembrane protein 30A

UniProt

Q8VEK0

Expression Region

2-364

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AMNYSAKDEVDGGPAGPPGGAAKTRRPDNTAFKQQRLPAWQPILTAGTVLPTFFIIGLIF IPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPNVTSCACTINFTLKQSFEGNVFMY YGLSNFYQNHRRYVKSRDDSQLNGDPSALLNPSKECEPYRRNEDRPIAPCGAIANSMFND TLELYLVANESDPKPIPIPLKKKGIAWWTDKNVKFRNPPGKESLEEKFKDTIKPVNWHKA VYELDPEDESNNGFINEDFIVWMRTAALPTFRKLYRLIERRDDLHPTLPAGQYFLNITYN YPVHSFDGRKRMILSTISWMGGKNPFLGIAYITIGSISFLLGVVLLVINHKYRNSSNTAD ITI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF205 Overexpression Lysate - (Dry Ice)
NBP2-09228 0.1 mg

ZNF205 Overexpression Lysate - (Dry Ice)

Sign In for Pricing
View Details
FTCD Antibody
orb1255610 100 µL

FTCD Antibody

Sign In for Pricing
View Details
Interleukin 10 (IL10) BioAssayTM ELISA Kit (Canine)
026056 96 Tests

Interleukin 10 (IL10) BioAssayTM ELISA Kit (Canine)

Sign In for Pricing
View Details
SEMA3G Rabbit Polyclonal Antibody (Cy7)
orb1079533 100 µL

SEMA3G Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
SFRS9 (SRSF9) Mouse Monoclonal Antibody [Clone 5A12]
E45M18397V-2 50 µL

SFRS9 (SRSF9) Mouse Monoclonal Antibody [Clone 5A12]

Sign In for Pricing
View Details
Lancl2 ORF Vector (Mouse) (pORF)
26294014 1.0 µg DNA

Lancl2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details