Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cell cycle control protein 50A (Tmem30a)

This Recombinant Mouse Cell cycle control protein 50A (Tmem30a) spans the amino acid sequence from region 2-364.

Product Specifications

Product Name Alternative

Cell cycle control protein 50A, Transmembrane protein 30A

UniProt

Q8VEK0

Expression Region

2-364

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AMNYSAKDEVDGGPAGPPGGAAKTRRPDNTAFKQQRLPAWQPILTAGTVLPTFFIIGLIF IPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPNVTSCACTINFTLKQSFEGNVFMY YGLSNFYQNHRRYVKSRDDSQLNGDPSALLNPSKECEPYRRNEDRPIAPCGAIANSMFND TLELYLVANESDPKPIPIPLKKKGIAWWTDKNVKFRNPPGKESLEEKFKDTIKPVNWHKA VYELDPEDESNNGFINEDFIVWMRTAALPTFRKLYRLIERRDDLHPTLPAGQYFLNITYN YPVHSFDGRKRMILSTISWMGGKNPFLGIAYITIGSISFLLGVVLLVINHKYRNSSNTAD ITI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue, Membrane Protein, Human Adult Normal, Adipose HisTekTM
T5595-1987 100 µg

Tissue, Membrane Protein, Human Adult Normal, Adipose HisTekTM

Sign In for Pricing
View Details
GENLISA™ Guinea Pig for Transforming Growth Factor Beta 1 (TGFb1) ELISA
KLY0174 1x 96 Well

GENLISA™ Guinea Pig for Transforming Growth Factor Beta 1 (TGFb1) ELISA

Sign In for Pricing
View Details
Tert-Amyl alcohol 99% For Synthesis
00261 00500 500 mL

Tert-Amyl alcohol 99% For Synthesis

Sign In for Pricing
View Details
Transferrin receptor 2 Antibody, mAb, Rabbit
A04441-50 50 µL

Transferrin receptor 2 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
G-[Ethyl-CONH- (PEG4) ]-ATP (Biotin)
E8604-78 50 µL

G-[Ethyl-CONH- (PEG4) ]-ATP (Biotin)

Sign In for Pricing
View Details
Spink4 (NM_011463) Mouse Tagged ORF Clone Lentiviral Particle
MR217713L3V 200 µL

Spink4 (NM_011463) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details