Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cell cycle control protein 50A (Tmem30a)

This Recombinant Mouse Cell cycle control protein 50A (Tmem30a) spans the amino acid sequence from region 2-364.

Product Specifications

Product Name Alternative

Cell cycle control protein 50A, Transmembrane protein 30A

UniProt

Q8VEK0

Expression Region

2-364

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AMNYSAKDEVDGGPAGPPGGAAKTRRPDNTAFKQQRLPAWQPILTAGTVLPTFFIIGLIF IPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPNVTSCACTINFTLKQSFEGNVFMY YGLSNFYQNHRRYVKSRDDSQLNGDPSALLNPSKECEPYRRNEDRPIAPCGAIANSMFND TLELYLVANESDPKPIPIPLKKKGIAWWTDKNVKFRNPPGKESLEEKFKDTIKPVNWHKA VYELDPEDESNNGFINEDFIVWMRTAALPTFRKLYRLIERRDDLHPTLPAGQYFLNITYN YPVHSFDGRKRMILSTISWMGGKNPFLGIAYITIGSISFLLGVVLLVINHKYRNSSNTAD ITI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Compound N037-0032
T131288-01 1 mg

Compound N037-0032

Sign In for Pricing
View Details
Compound N037-0032
T131288-02 5 mg

Compound N037-0032

Sign In for Pricing
View Details
FLNA Human Pre-designed siRNA Set A
HY-RS04979 1 Set

FLNA Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-IGFBP1 antibody
PAab04175 100 µg

Anti-IGFBP1 antibody

Sign In for Pricing
View Details
Polyclonal Antibody to Carbohydrate Antigen 125 (CA125)
TRV-0043587-01 20 µL

Polyclonal Antibody to Carbohydrate Antigen 125 (CA125)

Sign In for Pricing
View Details
Polyclonal Antibody to Carbohydrate Antigen 125 (CA125)
TRV-0043587-02 100 µL

Polyclonal Antibody to Carbohydrate Antigen 125 (CA125)

Sign In for Pricing
View Details